IGF-1 LR3
$30.00
IGF-1 LR3 (Insulin-Like Growth Factor-1 Long Arg3)
Description:
IGF-1 LR3 (Long R3 Insulin-Like Growth Factor-1) is a recombinant, modified analog of human IGF-1 designed to dramatically enhance biological activity, receptor affinity, and stability. It contains a 13-amino-acid extension at the N-terminus and a substitution of arginine for glutamic acid at position 3, which prevents binding to IGF-binding proteins (IGFBPs) — allowing greater bioavailability and sustained action. IGF-1 LR3 has been extensively studied for its potent anabolic, regenerative, and metabolic effects in muscle, neural, and tissue growth research.
Key Benefits:
Stimulates muscle cell growth, repair, and regeneration
Enhances protein synthesis and nutrient utilization
Promotes recovery and lean tissue development
Increases satellite cell activation and differentiation
Supports neuroprotection, anti-aging, and healing research
Mechanism of Action:
IGF-1 LR3 functions by binding to the IGF-1 receptor (IGF1R) and activating intracellular signaling cascades such as the PI3K/Akt and MAPK pathways, which regulate cell growth, survival, and metabolism. Its extended half-life (~20–30 hours vs. ~12 minutes for native IGF-1) and reduced affinity for IGFBPs make IGF-1 LR3 more effective in stimulating sustained anabolic activity. These unique properties make it a valuable peptide for studies involving muscle hypertrophy, tissue regeneration, and metabolic enhancement.
Molecular Formula: C400H625N111O115S9
Molecular Weight: 9117.19 g/mol
Sequence:MFPAMPLLSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Purity: ≥98% (HPLC)
Form: Lyophilized powder for reconstitution
Storage:
Store at −20°C. Protect from light, heat, and moisture. Once reconstituted, refrigerate (2–8°C) and use within 30 days. Avoid repeated freeze–thaw cycles.
Disclaimer:
For laboratory research use only. Not for human consumption.

