LL-37

LL-37 (Human Cathelicidin Antimicrobial Peptide)

Description:
LL-37 is a naturally occurring cationic antimicrobial peptide (AMP) derived from the human cathelicidin precursor protein (hCAP-18). It plays a critical role in innate immunity, functioning as both an antimicrobial defense moleculeand a tissue-repair modulator. LL-37 has been extensively studied for its ability to combat bacterial, viral, and fungal infections, while also exhibiting anti-inflammatory, wound-healing, and immunoregulatory properties.

Key Benefits:

• Broad-spectrum antimicrobial activity (bacteria, fungi, and viruses)

• Promotes tissue regeneration and accelerates wound healing

• Regulates inflammatory response and cytokine expression

• Enhances immune defense and epithelial barrier integrity

• Supports skin, lung, and mucosal immunity research

Mechanism of Action:
LL-37 exerts its effects through multiple mechanisms. It disrupts microbial membranes via amphipathic interaction, leading to rapid pathogen lysis. In host cells, LL-37 modulates Toll-like receptor (TLR) signaling, reducing excessive inflammation while promoting angiogenesis and tissue repair. It also acts as a chemotactic agent, recruiting immune cells such as macrophages and neutrophils to infection or injury sites. These diverse functions make LL-37 a central focus in antimicrobial resistance, immune regulation, and regenerative medicine research.

Molecular Formula: C189H317N55O43
Molecular Weight: 4493.3 g/mol
Sequence: [LL-37, 37 aa]
Purity: ≥98% (HPLC)
Form: Lyophilized powder for reconstitution

Storage:
Store at −20°C. Protect from light, heat, and moisture. Once reconstituted, refrigerate (2–8°C) and use within 30 days. Avoid repeated freeze–thaw cycles.

Disclaimer:
For laboratory research use only. Not for human consumption.