top of page

Tirzepatide

Price

$30.00

Tirzepatide (GLP-1/GIP Dual Receptor Agonist)

Description:
Tirzepatide is a groundbreaking dual incretin receptor agonist that simultaneously activates GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide) receptors. This dual-action mechanism provides synergistic effects on glucose regulation, insulin sensitivity, and appetite control. Research has demonstrated its powerful impact on weight managementmetabolic optimization, and glycemic balance.

Key Benefits:

  • Promotes significant and sustained weight reduction

  • Improves glucose metabolism and insulin response

  • Suppresses appetite and reduces food cravings

  • Supports cardiovascular and metabolic health

  • Enhances energy balance and fat oxidation

Mechanism of Action:
Tirzepatide mimics the actions of two key incretin hormones — GLP-1 and GIP — which work together to optimize metabolic control.

  • GLP-1 receptor activation increases insulin secretion, reduces glucagon release, and slows gastric emptying, helping regulate blood sugar and appetite.

  • GIP receptor activation complements these effects by enhancing insulin sensitivity and promoting efficient energy utilization.

This combined receptor stimulation leads to superior metabolic outcomes compared to single-pathway GLP-1 agonists, producing both enhanced weight loss and improved glycemic control.

Molecular Formula: C225H348N48O68
Molecular Weight: 4813.50 g/mol
Sequence: YGEGTFTSDLSKQMEEEAVRLFIEWLMNTKRNRNNIA
Purity: ≥98% (HPLC)
Form: Lyophilized powder for reconstitution

Storage:
Store at −20°C. Protect from heat, light, and moisture. Once reconstituted, refrigerate (2–8°C) and use within 30 days.

Disclaimer:
For laboratory research use only. Not for human consumption.

Size

bottom of page