Tirzepatide
$30.00
Tirzepatide (GLP-1/GIP Dual Receptor Agonist)
Description:
Tirzepatide is a groundbreaking dual incretin receptor agonist that simultaneously activates GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide) receptors. This dual-action mechanism provides synergistic effects on glucose regulation, insulin sensitivity, and appetite control. Research has demonstrated its powerful impact on weight management, metabolic optimization, and glycemic balance.
Key Benefits:
Promotes significant and sustained weight reduction
Improves glucose metabolism and insulin response
Suppresses appetite and reduces food cravings
Supports cardiovascular and metabolic health
Enhances energy balance and fat oxidation
Mechanism of Action:
Tirzepatide mimics the actions of two key incretin hormones — GLP-1 and GIP — which work together to optimize metabolic control.
GLP-1 receptor activation increases insulin secretion, reduces glucagon release, and slows gastric emptying, helping regulate blood sugar and appetite.
GIP receptor activation complements these effects by enhancing insulin sensitivity and promoting efficient energy utilization.
This combined receptor stimulation leads to superior metabolic outcomes compared to single-pathway GLP-1 agonists, producing both enhanced weight loss and improved glycemic control.
Molecular Formula: C225H348N48O68
Molecular Weight: 4813.50 g/mol
Sequence: YGEGTFTSDLSKQMEEEAVRLFIEWLMNTKRNRNNIA
Purity: ≥98% (HPLC)
Form: Lyophilized powder for reconstitution
Storage:
Store at −20°C. Protect from heat, light, and moisture. Once reconstituted, refrigerate (2–8°C) and use within 30 days.
Disclaimer:
For laboratory research use only. Not for human consumption.

